Gamma-Enolase (ENO2) Antibody

Catalogue No: abx131862
Price: £200.00
(Size: 100 µl)
Reviews: 0 reviews
(0 reviews)

Click on the image to see the image legend

Available Options

* Size:



ENO2 Antibody is a Mouse Monoclonal against ENO2.

Target Gamma-Enolase (ENO2)
Clonality Monoclonal
Reactivity Human
Tested Applications WB, IHC, IF/ICC
Host Mouse
Recommended dilutions WB: 0.5-5 µg/ml, IHC: 5-30 µg/ml, IF/ICC: 5-30 µg/ml. Optimal dilutions/concentrations should be determined by the end user.
Conjugation Unconjugated
Immunogen Ser2-Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT
Isotype IgG2b Kappa
Form Liquid
Purification Purified by Protein A and Protein G affinity chromatography.
Storage Aliquot and store at -20°C. Avoid repeated freeze/thaw cycles.
UniProt Primary AC P09104 (UniProt, ExPASy)
UniProt Secondary AC B7Z2X9, Q96J33
UniProt Entry Name ENOG_HUMAN
KEGG hsa:2026
String 9606.ENSP00000437402
Buffer 0.01 M PBS, pH 7.4, containing 0.05% Proclin-300, 50% glycerol.
Availability Shipped within 5-7 working days.
Note This product is for research use only.
Research Articles on Gamma-Enolase (ENO2)

Write a review

Your Name
Your Email Address
PMID
DOI
Your Review

Note: HTML is not translated!

Rating Bad Good

Tags:
(Click to show)