Rat Heme Oxygenase 1 (HMOX1) Protein

REQUEST MORE INFO
Catalogue No: abx675041
Price: US$507.50
(Size: 50 µg)

Click on the image to see the image legend

Available Options

* Size:



Add to Shopping Cart Buy It Now GET A QUOTE

Documents

Datasheet SDS
HO-1 Protein is a protein produced in Rat.

Target Heme Oxygenase 1 (HMOX1)
Origin Rat
Expression Recombinant
Tested Applications WB, SDS-PAGE
Host E. coli
Purity > 90%
Purification Purified by affinity chromatography.
Storage Store at -20°C.
UniProt Primary AC P06762 (UniProt, ExPASy)
UniProt Secondary AC Q5BK87
UniProt Entry Name HMOX1_RAT
GeneID 24451
NCBI Accession NP_036712.1
KEGG rno:24451
String 10116.ENSRNOP00000019192
Molecular Weight 32 kDa
Sequence Fragment Partial
Sequence MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQIST
Tag His tag
Buffer 50 mM Tris/HCl pH7.5, 5 mM Bme, 0.15NaCl, 10% glycerol.
Availability Shipped within 5-12 working days.
Note This product is for research use only.

Not for human consumption, cosmetic, therapeutic or diagnostic use.
Research Articles on Heme Oxygenase 1 (HMOX1)


Write a review