+44 (0) 1223 755950
+1 832 327 7413
Click on the image to see the image legend
Target | Heme Oxygenase 1 (HMOX1) |
Origin | Rat |
Expression | Recombinant |
Tested Applications | WB, SDS-PAGE |
Host | E. coli |
Purity | > 90% |
Purification | Purified by affinity chromatography. |
Storage | Store at -20°C. |
UniProt Primary AC | P06762 (UniProt, ExPASy) |
UniProt Secondary AC | Q5BK87 |
UniProt Entry Name | HMOX1_RAT |
GeneID | 24451 |
NCBI Accession | NP_036712.1 |
KEGG | rno:24451 |
String | 10116.ENSRNOP00000019192 |
Molecular Weight | 32 kDa |
Sequence Fragment | Partial |
Sequence | MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQIST |
Tag | His tag |
Buffer | 50 mM Tris/HCl pH7.5, 5 mM Bme, 0.15NaCl, 10% glycerol. |
Availability | Shipped within 5-12 working days. |
Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |