+44 (0) 1223 755950
+1 832 327 7413
Click on the image to see the image legend
Target | Neuregulin 1 (NRG1) |
Origin | Human |
Expression | Recombinant |
Tested Applications | SDS-PAGE |
Conjugation | Unconjugated |
Form | Lyophilized |
Purity | > 96% (SDS-PAGE and RP-HPLC) |
UniProt Primary AC | Q02297 (UniProt, ExPASy) |
Sequence | SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ. |
Availability | Shipped within 5-10 working days. |
Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |