Interleukin 7 Receptor (IL7R) Antibody

REQUEST MORE INFO
Catalogue No: abx113256
Price: US$710.50
(Size: 100 µl)

Click on the image to see the image legend

Available Options

* Size:

Add to Shopping Cart Buy It Now GET A QUOTE

Documents

Datasheet SDS
Interleukin 7 Receptor Antibody is a Rabbit Polyclonal antibody against Interleukin 7 Receptor.

Target Interleukin 7 Receptor (IL7R)
Clonality Polyclonal
Reactivity Human, Mouse
Tested Applications ELISA, WB
Host Rabbit
Recommended dilutions Optimal dilutions/concentrations should be determined by the end user.
Conjugation Unconjugated
Immunogen Human IL7R.
Isotype IgG
Form Liquid
Purification Antigen Affinity Chromatography.
Storage Aliquot and store at -20°C. Avoid repeated freeze/thaw cycles.
UniProt Primary AC P16871 (UniProt, ExPASy)
UniProt Entry Name IL7RA_HUMAN
Gene Symbol IL7R
GeneID 3575
OMIM 146661
NCBI Accession NP_002176.2
KEGG hsa:3575
String 9606.ENSP00000306157
Sequence KRIKPIVWPSLPDHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPESFGRDSSLTCLAGNVSACDAPILSPSRSLDCRESGKNGPHVYQDLLLSLGTTNSTLPPPFSLQSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQ
Buffer PBS, pH 7.3, containing 0.1% Sodium Azide and 50% Glycerol.
Availability Shipped within 5-10 working days.
Note This product is for research use only.
Research Articles on Interleukin 7 Receptor (IL7R)


Write a review

Tags:
(Click to show)