+44 (0) 1223 755950
+1 832 327 7413
Click on the image to see the image legend
Target | Sulfonylurea Receptor 2 (SUR2A) |
Clonality | Monoclonal |
Reactivity | Human, Mouse, Rat |
Tested Applications | WB, IHC, IF/ICC |
Host | Mouse |
Recommended dilutions | WB: 1/1000. Optimal dilutions/concentrations should be determined by the end user. |
Conjugation | HRP |
Immunogen | Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A. |
Isotype | IgG2A |
Purification | Purified by Protein G. |
Storage | Aliquot and store at -20°C. Avoid repeated freeze/thaw cycles. |
UniProt Primary AC | P70170 (UniProt, ExPASy) |
UniProt Secondary AC | O08902, O08920, P70171 |
UniProt Entry Name | ABCC9_MOUSE |
GeneID | 20928 |
NCBI Accession | NP_001038185.1 |
KEGG | mmu:20928 |
String | 10090.ENSMUSP00000084805 |
Buffer | PBS, pH 7.4, 50% glycerol, 0.1% sodium azide. |
Specificity | Detects ~120kDa. Does not cross-react with SUR2B. |
Concentration | 1 mg/ml |
Availability | Shipped within 5-12 working days. |
Note | This product is for research use only. |