+44 (0) 1223 755950
+1 832 327 7413
Sulfonylurea Receptor 2 (SUR2A) Antibody (ATTO594)
REQUEST MORE INFO
Catalogue No: abx441034
Price:
US$710.50
(Size: 100 µg)
Reviews: 
(0 Publications and Reviews)
(0 Publications and Reviews)
Click on the image to see the image legend
SUR2A Antibody is a Mouse Monoclonal against SUR2A.
Research Articles on Sulfonylurea Receptor 2 (SUR2A)
| Target | Sulfonylurea Receptor 2 (SUR2A) |
| Clonality | Monoclonal |
| Reactivity | Human, Mouse, Rat |
| Tested Applications | WB, IHC, IF/ICC |
| Host | Mouse |
| Recommended dilutions | WB: 1/1000. Optimal dilutions/concentrations should be determined by the end user. |
| Conjugation | ATTO594 |
| Excitation/Emission | 603/626 |
| Laser Line | 594 |
| Immunogen | Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A. |
| Isotype | IgG2A |
| Purification | Purified by Protein G. |
| Storage | Aliquot and store at -20°C. Avoid repeated freeze/thaw cycles. |
| UniProt Primary AC | P70170 (UniProt, ExPASy) |
| UniProt Secondary AC | O08902, O08920, P70171 |
| UniProt Entry Name | ABCC9_MOUSE |
| GeneID | 20928 |
| NCBI Accession | NP_001038185.1 |
| KEGG | mmu:20928 |
| String | 10090.ENSMUSP00000084805 |
| Buffer | PBS, pH 7.4, 50% glycerol, 0.1% sodium azide. |
| Specificity | Detects ~120kDa. Does not cross-react with SUR2B. |
| Concentration | 1 mg/ml |
| Availability | Shipped within 5-12 working days. |
| Note | This product is for research use only. |
