+44 (0) 1223 755950
+1 832 327 7413
Click on the image to see the image legend
Target | TNFR |
Origin | Human |
Expression | Recombinant |
Tested Applications | SDS-PAGE |
Conjugation | Unconjugated |
Form | Liquid |
Purity | > 95% (SDS-PAGE) |
UniProt Primary AC | P19438 (UniProt, ExPASy) |
UniProt Entry Name | TNR1A_HUMAN |
KEGG | hsa:7132 |
String | 9606.ENSP00000162749 |
Sequence | DSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN. |
Tag | His tag |
Activity | Not tested |
Availability | Shipped within 5-10 working days. |
Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |